PDE1B monoclonal antibody (M01), clone 5B6
  • PDE1B monoclonal antibody (M01), clone 5B6

PDE1B monoclonal antibody (M01), clone 5B6

Ref: AB-H00005153-M01
PDE1B monoclonal antibody (M01), clone 5B6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PDE1B.
Información adicional
Size 100 ug
Gene Name PDE1B
Gene Alias PDE1B1|PDES1B
Gene Description phosphodiesterase 1B, calmodulin-dependent
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq TDVAEKSVQPLADEDSKSKNQPSFQWRQPSLDVEVGDPNPDVVSFRSTWVKRIQENKQKWKERAASGITNQMSIDELSPCEEEAPPSPAEDEHNQNGNLD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PDE1B (AAH32226, 437 a.a. ~ 536 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5153
Clone Number 5B6
Iso type IgG2a Kappa

Enviar un mensaje


PDE1B monoclonal antibody (M01), clone 5B6

PDE1B monoclonal antibody (M01), clone 5B6