PDE8A monoclonal antibody (M02), clone 1H6
  • PDE8A monoclonal antibody (M02), clone 1H6

PDE8A monoclonal antibody (M02), clone 1H6

Ref: AB-H00005151-M02
PDE8A monoclonal antibody (M02), clone 1H6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PDE8A.
Información adicional
Size 100 ug
Gene Name PDE8A
Gene Alias FLJ16150|HsT19550
Gene Description phosphodiesterase 8A
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq RLPQGQKTAALPRTRGAGLLESELRDGSGKKVAVADVQFGPMRFHQDQLQVLLVFTKEDNQCNGFCRACEKAGFKCTVTKEAQAVLACFL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PDE8A (NP_002596.1, 32 a.a. ~ 121 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5151
Clone Number 1H6
Iso type IgG2a Kappa

Enviar un mensaje


PDE8A monoclonal antibody (M02), clone 1H6

PDE8A monoclonal antibody (M02), clone 1H6