PDE7A polyclonal antibody (A01)
  • PDE7A polyclonal antibody (A01)

PDE7A polyclonal antibody (A01)

Ref: AB-H00005150-A01
PDE7A polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PDE7A.
Información adicional
Size 50 uL
Gene Name PDE7A
Gene Alias HCP1|PDE7
Gene Description phosphodiesterase 7A
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq TSKRRGAISYDSSDQTALYIRMLGDVRVRSRAGFESERRGSHPYIDFRIFHSQSEIEVSVSARNIRRLLSFQRYLRSSRFFRGTAVSNSLNILDDDYNGQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PDE7A (NP_002594, 18 a.a. ~ 117 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5150

Enviar un mensaje


PDE7A polyclonal antibody (A01)

PDE7A polyclonal antibody (A01)