PDE6C polyclonal antibody (A01)
  • PDE6C polyclonal antibody (A01)

PDE6C polyclonal antibody (A01)

Ref: AB-H00005146-A01
PDE6C polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PDE6C.
Información adicional
Size 50 uL
Gene Name PDE6C
Gene Alias PDEA2
Gene Description phosphodiesterase 6C, cGMP-specific, cone, alpha prime
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq EINQVAVEKYLEENPQFAKEYFDRKLRVEVLGEIFKNSQVPVQSSMSFSELTQVEESALCLELLWTVQEEGGTPEQGVHRALQRLAHLLQADRCSMFL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PDE6C (NP_006195, 3 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5146

Enviar un mensaje


PDE6C polyclonal antibody (A01)

PDE6C polyclonal antibody (A01)