PDE4C monoclonal antibody (M02), clone 4E5
  • PDE4C monoclonal antibody (M02), clone 4E5

PDE4C monoclonal antibody (M02), clone 4E5

Ref: AB-H00005143-M02
PDE4C monoclonal antibody (M02), clone 4E5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PDE4C.
Información adicional
Size 100 ug
Gene Name PDE4C
Gene Alias DPDE1|MGC126222
Gene Description phosphodiesterase 4C, cAMP-specific (phosphodiesterase E1 dunce homolog, Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq MENLGVGEGAEACSRLSRSRGRHSMTRAPKHLWRQPRRPIRIQQRFYSDPDKSAGCRERDLSPRPELRKSRLSWPVSSCRRFDLENGLSCGRRALDPQS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PDE4C (NP_000914, 1 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5143
Clone Number 4E5
Iso type IgG3 Kappa

Enviar un mensaje


PDE4C monoclonal antibody (M02), clone 4E5

PDE4C monoclonal antibody (M02), clone 4E5