PDE3A monoclonal antibody (M01), clone 5C12
  • PDE3A monoclonal antibody (M01), clone 5C12

PDE3A monoclonal antibody (M01), clone 5C12

Ref: AB-H00005139-M01
PDE3A monoclonal antibody (M01), clone 5C12

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PDE3A.
Información adicional
Size 100 ug
Gene Name PDE3A
Gene Alias CGI-PDE
Gene Description phosphodiesterase 3A, cGMP-inhibited
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq TPASSLVSKISAVQFPESADTTAKQSLGSHRALTYTQSAPDLSPQILTPPVICSSCGRPYSQGNPADEPLERSGVATRTPSRTDDTAQVTSDYETNNNSDSSDIVQNE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PDE3A (NP_000912, 533 a.a. ~ 640 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5139
Clone Number 5C12
Iso type IgG1 Kappa

Enviar un mensaje


PDE3A monoclonal antibody (M01), clone 5C12

PDE3A monoclonal antibody (M01), clone 5C12