PDE3A polyclonal antibody (A01)
  • PDE3A polyclonal antibody (A01)

PDE3A polyclonal antibody (A01)

Ref: AB-H00005139-A01
PDE3A polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PDE3A.
Información adicional
Size 50 uL
Gene Name PDE3A
Gene Alias CGI-PDE
Gene Description phosphodiesterase 3A, cGMP-inhibited
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq TPASSLVSKISAVQFPESADTTAKQSLGSHRALTYTQSAPDLSPQILTPPVICSSCGRPYSQGNPADEPLERSGVATRTPSRTDDTAQVTSDYETNNNSDSSDIVQNE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PDE3A (NP_000912, 533 a.a. ~ 640 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5139

Enviar un mensaje


PDE3A polyclonal antibody (A01)

PDE3A polyclonal antibody (A01)