PDE2A monoclonal antibody (M01), clone 4F4
  • PDE2A monoclonal antibody (M01), clone 4F4

PDE2A monoclonal antibody (M01), clone 4F4

Ref: AB-H00005138-M01
PDE2A monoclonal antibody (M01), clone 4F4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PDE2A.
Información adicional
Size 100 ug
Gene Name PDE2A
Gene Alias PDE2A1|PED2A4
Gene Description phosphodiesterase 2A, cGMP-stimulated
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq REKAYIPELQISFMEHIAMPIYKLLQDLFPKAAELYERVASNREHWTKVSHKFTIRGLPSNNSLDFLDEEYEVPDLDGTRAPINGCCSLDA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PDE2A (NP_002590, 850 a.a. ~ 940 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5138
Clone Number 4F4
Iso type IgG2a Kappa

Enviar un mensaje


PDE2A monoclonal antibody (M01), clone 4F4

PDE2A monoclonal antibody (M01), clone 4F4