PDE2A polyclonal antibody (A01)
  • PDE2A polyclonal antibody (A01)

PDE2A polyclonal antibody (A01)

Ref: AB-H00005138-A01
PDE2A polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PDE2A.
Información adicional
Size 50 uL
Gene Name PDE2A
Gene Alias PDE2A1|PED2A4
Gene Description phosphodiesterase 2A, cGMP-stimulated
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq REKAYIPELQISFMEHIAMPIYKLLQDLFPKAAELYERVASNREHWTKVSHKFTIRGLPSNNSLDFLDEEYEVPDLDGTRAPINGCCSLDA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PDE2A (NP_002590, 850 a.a. ~ 940 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5138

Enviar un mensaje


PDE2A polyclonal antibody (A01)

PDE2A polyclonal antibody (A01)