PCSK2 monoclonal antibody (M01), clone 3H4
  • PCSK2 monoclonal antibody (M01), clone 3H4

PCSK2 monoclonal antibody (M01), clone 3H4

Ref: AB-H00005126-M01
PCSK2 monoclonal antibody (M01), clone 3H4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PCSK2.
Información adicional
Size 100 ug
Gene Name PCSK2
Gene Alias NEC2|PC2|SPC2
Gene Description proprotein convertase subtilisin/kexin type 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq VRYLEHVQAVITVNATRRGDLNINMTSPMGTKSILLSRRPRDDDSKVGFDKWPFMTTHTWGEDARGTWTLELGFVGSAPQKGVLKEWTLMLHGTQSAPYIDQVVRDYQS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PCSK2 (NP_002585.2, 501 a.a. ~ 609 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5126
Clone Number 3H4
Iso type IgG2a Kappa

Enviar un mensaje


PCSK2 monoclonal antibody (M01), clone 3H4

PCSK2 monoclonal antibody (M01), clone 3H4