PCP4 monoclonal antibody (M14), clone 1E3
  • PCP4 monoclonal antibody (M14), clone 1E3

PCP4 monoclonal antibody (M14), clone 1E3

Ref: AB-H00005121-M14
PCP4 monoclonal antibody (M14), clone 1E3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PCP4.
Información adicional
Size 100 ug
Gene Name PCP4
Gene Alias PEP-19
Gene Description Purkinje cell protein 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MSERQGAGATNGKDKTSGENDGQKKVQEEFDIDMDAPETERAAVAIQSQFRKFQKKKAGSQS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PCP4 (NP_006189.2, 1 a.a. ~ 62 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5121
Clone Number 1E3
Iso type IgG2a Kappa

Enviar un mensaje


PCP4 monoclonal antibody (M14), clone 1E3

PCP4 monoclonal antibody (M14), clone 1E3