CHMP1A purified MaxPab rabbit polyclonal antibody (D01P)
  • CHMP1A purified MaxPab rabbit polyclonal antibody (D01P)

CHMP1A purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00005119-D01P
CHMP1A purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CHMP1A protein.
Información adicional
Size 100 ug
Gene Name CHMP1A
Gene Alias CHMP1|KIAA0047|PCOLN3|PRSM1
Gene Description chromatin modifying protein 1A
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MDDTLFQLKFTAKQLEKLAKKAEKDSKAEQAKVKKALLQKNVECARVYAENAIRKKNEGVNWLRMASRVDAVASKVQTAVTMKGVTKNMAQVTKALDKALSTMDLQKVSSVMDRFEQQVQNLDVHTSVMEDSMSSATTLTTPQEQVDSLIMQIAEENGLEVLDQLSQLPEGASAVGESSVRSQEDQLSRRLAALRN
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CHMP1A (NP_002759.2, 1 a.a. ~ 196 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5119

Enviar un mensaje


CHMP1A purified MaxPab rabbit polyclonal antibody (D01P)

CHMP1A purified MaxPab rabbit polyclonal antibody (D01P)