PCNA purified MaxPab mouse polyclonal antibody (B01P)
  • PCNA purified MaxPab mouse polyclonal antibody (B01P)

PCNA purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00005111-B01P
PCNA purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human PCNA protein.
Información adicional
Size 50 ug
Gene Name PCNA
Gene Alias MGC8367
Gene Description proliferating cell nuclear antigen
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKI
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PCNA (NP_002583.1, 1 a.a. ~ 261 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5111

Enviar un mensaje


PCNA purified MaxPab mouse polyclonal antibody (B01P)

PCNA purified MaxPab mouse polyclonal antibody (B01P)