PCNA polyclonal antibody (A02)
  • PCNA polyclonal antibody (A02)

PCNA polyclonal antibody (A02)

Ref: AB-H00005111-A02
PCNA polyclonal antibody (A02)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PCNA.
Información adicional
Size 50 uL
Gene Name PCNA
Gene Alias MGC8367
Gene Description proliferating cell nuclear antigen
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq SHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEEGS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PCNA (NP_002583, 152 a.a. ~ 261 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5111

Enviar un mensaje


PCNA polyclonal antibody (A02)

PCNA polyclonal antibody (A02)