PCDH7 monoclonal antibody (M01), clone 2D7
  • PCDH7 monoclonal antibody (M01), clone 2D7

PCDH7 monoclonal antibody (M01), clone 2D7

Ref: AB-H00005099-M01
PCDH7 monoclonal antibody (M01), clone 2D7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PCDH7.
Información adicional
Size 100 ug
Gene Name PCDH7
Gene Alias BH-Pcdh|BHPCDH
Gene Description protocadherin 7
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq KQLLRYRLAEEGPADVRIGNVASDLGIVTGSGEVTFSLESGSEYLKIDNLTGELSTSERRIDREKLPQCQMIFDENECFLDFEVSVIGPSQSWV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PCDH7 (NP_002580, 31 a.a. ~ 124 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5099
Clone Number 2D7
Iso type IgG2a Kappa

Enviar un mensaje


PCDH7 monoclonal antibody (M01), clone 2D7

PCDH7 monoclonal antibody (M01), clone 2D7