PCDH1 monoclonal antibody (M02), clone 4H2
  • PCDH1 monoclonal antibody (M02), clone 4H2

PCDH1 monoclonal antibody (M02), clone 4H2

Ref: AB-H00005097-M02
PCDH1 monoclonal antibody (M02), clone 4H2

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PCDH1.
Información adicional
Size 100 ug
Gene Name PCDH1
Gene Alias FLJ53887|MGC45991|PC42|PCDH42
Gene Description protocadherin 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq YKVPEEQPPNTLIGSLAADYGFPDVGHLYKLEVGAPYLRVDGKTGDIFTTETSIDREGLRECQNQLPGDPCILEFEVSITDLVQNGSPRLLEGQIEVQDINDNTPNFA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PCDH1 (NP_002578, 62 a.a. ~ 169 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5097
Clone Number 4H2
Iso type IgG2b Kappa

Enviar un mensaje


PCDH1 monoclonal antibody (M02), clone 4H2

PCDH1 monoclonal antibody (M02), clone 4H2