PCBP1 monoclonal antibody (M01), clone 1G2
  • PCBP1 monoclonal antibody (M01), clone 1G2

PCBP1 monoclonal antibody (M01), clone 1G2

Ref: AB-H00005093-M01
PCBP1 monoclonal antibody (M01), clone 1G2

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PCBP1.
Información adicional
Size 50 ug
Gene Name PCBP1
Gene Alias HNRPE1|HNRPX|hnRNP-E1|hnRNP-X
Gene Description poly(rC) binding protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,S-ELISA,ELISA,IF
Immunogen Prot. Seq IPYQPMPASSPVICAGGQDRCSDAAGYPHATHDLEGPPLDAYSIQGQHTISPLDLAKLNQVARQQSHFAMMHGGTGFAGIDSSSPEVKGYWASLDASTQT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PCBP1 (AAH39742, 181 a.a. ~ 280 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5093
Clone Number 1G2
Iso type IgG2a Kappa

Enviar un mensaje


PCBP1 monoclonal antibody (M01), clone 1G2

PCBP1 monoclonal antibody (M01), clone 1G2