PBX3 monoclonal antibody (M01), clone 1A9
  • PBX3 monoclonal antibody (M01), clone 1A9

PBX3 monoclonal antibody (M01), clone 1A9

Ref: AB-H00005090-M01
PBX3 monoclonal antibody (M01), clone 1A9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PBX3.
Información adicional
Size 100 ug
Gene Name PBX3
Gene Alias -
Gene Description pre-B-cell leukemia homeobox 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq FNLPNSGDMFMNMQSLNGDSYQGSQVGANVQSQVDTLRHVINQTGGYSDGLGGNSLYSPHNLNANGGWQDATTPSSVTSPTEGPGSVHSDTSN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PBX3 (NP_006186, 342 a.a. ~ 434 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5090
Clone Number 1A9
Iso type IgG2a Kappa

Enviar un mensaje


PBX3 monoclonal antibody (M01), clone 1A9

PBX3 monoclonal antibody (M01), clone 1A9