PBX2 MaxPab rabbit polyclonal antibody (D01)
  • PBX2 MaxPab rabbit polyclonal antibody (D01)

PBX2 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00005089-D01
PBX2 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human PBX2 protein.
Información adicional
Size 100 uL
Gene Name PBX2
Gene Alias G17|HOX12|PBX2MHC
Gene Description pre-B-cell leukemia homeobox 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key IP
Immunogen Prot. Seq MDERLLGPPPPGGGRGGLGLVSGEPGGPGEPPGGGDPGGGSGGVPGGRGKQDIGDILQQIMTITDQSLDEAQAKKHALNCHRMKPALFSVLCEIKEKTGLSIRSSQEEEPVDPQLMRLDNMLLAEGVAGPEKGGGSAAAAAAAAASGGGVSPDNSIEHSDYRSKLAQIRHIYHSELEKYEQACNEFTTHVMNLLREQSRTRPVAPKEMERMVSIIHRKFSAIQMQLKQSTCEAVMILRSRFLDARRKRRNFSKQA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PBX2 (NP_002577.2, 1 a.a. ~ 430 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 5089

Enviar un mensaje


PBX2 MaxPab rabbit polyclonal antibody (D01)

PBX2 MaxPab rabbit polyclonal antibody (D01)