PBX1 polyclonal antibody (A01)
  • PBX1 polyclonal antibody (A01)

PBX1 polyclonal antibody (A01)

Ref: AB-H00005087-A01
PBX1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PBX1.
Información adicional
Size 50 uL
Gene Name PBX1
Gene Alias DKFZp686B09108|MGC126627
Gene Description pre-B-cell leukemia homeobox 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MQLKQSTCEAVMILRSRFLDARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYKKNIGKFQEEANIYAAKTAVTATNVSAHGS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PBX1 (NP_002576, 213 a.a. ~ 321 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5087

Enviar un mensaje


PBX1 polyclonal antibody (A01)

PBX1 polyclonal antibody (A01)