PAX9 monoclonal antibody (M03), clone 4B9
  • PAX9 monoclonal antibody (M03), clone 4B9

PAX9 monoclonal antibody (M03), clone 4B9

Ref: AB-H00005083-M03
PAX9 monoclonal antibody (M03), clone 4B9

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant PAX9.
Información adicional
Size 100 ug
Gene Name PAX9
Gene Alias -
Gene Description paired box 9
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,ELISA,RNAi-Ab
Immunogen Prot. Seq RSITDQVSDSSPYHSPKVEEWSSLGRNNFPAAAPHAVNGLEKGALEQEAKYGQAPNGLPAVGSFVSASSMAPYPTPAQVSPYMTYSAAPSGYVAGH
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PAX9 (NP_006185, 205 a.a. ~ 300 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5083
Clone Number 4B9
Iso type IgG2b Kappa

Enviar un mensaje


PAX9 monoclonal antibody (M03), clone 4B9

PAX9 monoclonal antibody (M03), clone 4B9