PAX9 purified MaxPab mouse polyclonal antibody (B01P)
  • PAX9 purified MaxPab mouse polyclonal antibody (B01P)

PAX9 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00005083-B01P
PAX9 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human PAX9 protein.
Información adicional
Size 50 ug
Gene Name PAX9
Gene Alias -
Gene Description paired box 9
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MEPAFGEVNQLGGVFVNGRPLPNAIRLRIVELAQLGIRPCDISRQLRVSHGCVSKILARYNETGSILPGAIGGSKPRVTTPTVVKHIRTYKQRDPGIFAWEIRDRLLADGVCDKYNVPSVSSISRILRNKIGNLAQQGHYDSYKQHQPTPQPALPYNHIYSYPSPITAAAAKVPTPPGVPAIPGSVAMPRTWPSSHSVTDILGIRSITDQVSDSSPYHSPKVEEWSSLGRNNFPAAAPHAVNGLEKGALEQEAKY
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PAX9 (NP_006185.1, 1 a.a. ~ 341 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5083

Enviar un mensaje


PAX9 purified MaxPab mouse polyclonal antibody (B01P)

PAX9 purified MaxPab mouse polyclonal antibody (B01P)