PAX7 monoclonal antibody (M13), clone 2B9
  • PAX7 monoclonal antibody (M13), clone 2B9

PAX7 monoclonal antibody (M13), clone 2B9

Ref: AB-H00005081-M13
PAX7 monoclonal antibody (M13), clone 2B9

Información del producto

Mouse monoclonal antibody raised against a full length recombinant PAX7.
Información adicional
Size 100 ug
Gene Name PAX7
Gene Alias HUP1|PAX7B
Gene Description paired box 7
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq AYGARHSFSSYSDSFMNPAAPSNHMNPVSNGLSPQVMSILGNPSAVPPQPQADFSISPLHGGLDSATSISASCSQRADSIKPGD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PAX7 (NP_001128726.1, 351 a.a. ~ 434 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5081
Clone Number 2B9
Iso type IgG2b Kappa

Enviar un mensaje


PAX7 monoclonal antibody (M13), clone 2B9

PAX7 monoclonal antibody (M13), clone 2B9