PAX5 monoclonal antibody (M01), clone 8F9
  • PAX5 monoclonal antibody (M01), clone 8F9

PAX5 monoclonal antibody (M01), clone 8F9

Ref: AB-H00005079-M01
PAX5 monoclonal antibody (M01), clone 8F9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PAX5.
Información adicional
Size 100 ug
Gene Name PAX5
Gene Alias BSAP
Gene Description paired box 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,IHC-P,S-ELISA,ELISA,RNAi-Ab
Immunogen Prot. Seq ADTNKRKRDEGIQESPVPNGHSLPGRDFLRKQMRGDLFTQQQLEVLDRVFERQHYSDIFTTTEPIKPEQTTEYSAMASLAGGLDDMKANLASPTPADIGSSVPGPQSYPI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PAX5 (NP_057953, 192 a.a. ~ 301 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5079
Clone Number 8F9
Iso type IgG1 Kappa

Enviar un mensaje


PAX5 monoclonal antibody (M01), clone 8F9

PAX5 monoclonal antibody (M01), clone 8F9