PAX4 purified MaxPab rabbit polyclonal antibody (D01P)
  • PAX4 purified MaxPab rabbit polyclonal antibody (D01P)

PAX4 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00005078-D01P
PAX4 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human PAX4 protein.
Información adicional
Size 100 ug
Gene Name PAX4
Gene Alias KPD|MGC129960|MODY9
Gene Description paired box 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MNQLGGLFVNGRPLPLDTRQQIVRLAVSGMRPCDISRILKVSNGCVSKILGRYYRTGVLEPKGIGGSKPRLATPPVVARIAQLKGECPALFAWEIQRQLCAEGLCTQDKTPSVSSINRVLRALQEDQGLPCTRLRSPAVLAPAVLTPHSGSETPRGTHPGTGHRNRTIFSPSQAEALEKEFQRGQYPDSVARGKLATATSLPEDTVRVWFSNRRAKWRRQEKLKWEMQLPGASQGLTVPRVAPGIISAQQSPGSV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PAX4 (NP_006184.1, 1 a.a. ~ 343 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5078

Enviar un mensaje


PAX4 purified MaxPab rabbit polyclonal antibody (D01P)

PAX4 purified MaxPab rabbit polyclonal antibody (D01P)