PAX3 monoclonal antibody (M06), clone 3A8
  • PAX3 monoclonal antibody (M06), clone 3A8

PAX3 monoclonal antibody (M06), clone 3A8

Ref: AB-H00005077-M06
PAX3 monoclonal antibody (M06), clone 3A8

Información del producto

Mouse monoclonal antibody raised against a full length recombinant PAX3.
Información adicional
Size 100 ug
Gene Name PAX3
Gene Alias CDHS|HUP2|MGC120381|MGC120382|MGC120383|MGC120384|MGC134778|WS1
Gene Description paired box 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq LSETSYQPTSIPQAVSDPSSTVHRPQPLPPSTVHQSTIPSNPDSSSAYCLPSTRHGFSSYTDSFVPPSGPSNPMNPTIGNGLSPQVMGLLTNHGGVPHQPQTDYALSP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PAX3 (NP_852122, 307 a.a. ~ 414 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5077
Clone Number 3A8
Iso type IgG2b Kappa

Enviar un mensaje


PAX3 monoclonal antibody (M06), clone 3A8

PAX3 monoclonal antibody (M06), clone 3A8