PALM monoclonal antibody (M09), clone 7C5
  • PALM monoclonal antibody (M09), clone 7C5

PALM monoclonal antibody (M09), clone 7C5

Ref: AB-H00005064-M09
PALM monoclonal antibody (M09), clone 7C5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PALM.
Información adicional
Size 100 ug
Gene Name PALM
Gene Alias KIAA0270
Gene Description paralemmin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq VEKDKVTGETRVLSSTTLLPRQPLPLGIKVYEDETKVVHAVDGTAENGIHPLSSSEVDELIHKADEVTLSEAGSTAGAAETRGAVEGAARTTPSRREITGVQAQPGEAT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PALM (NP_005839, 176 a.a. ~ 284 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5064
Clone Number 7C5
Iso type IgG3 Kappa

Enviar un mensaje


PALM monoclonal antibody (M09), clone 7C5

PALM monoclonal antibody (M09), clone 7C5