PAK3 monoclonal antibody (M07), clone 1H7
  • PAK3 monoclonal antibody (M07), clone 1H7

PAK3 monoclonal antibody (M07), clone 1H7

Ref: AB-H00005063-M07
PAK3 monoclonal antibody (M07), clone 1H7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PAK3.
Información adicional
Size 100 ug
Gene Name PAK3
Gene Alias CDKN1A|MRX30|MRX47|OPHN3|PAK3beta|bPAK|hPAK3
Gene Description p21 protein (Cdc42/Rac)-activated kinase 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA,IF
Immunogen Prot. Seq MSDGLDNEEKPPAPPLRMNSNNRDSSALNHSSKPLPMAPEEKNKKARLRSIFPGGGDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PAK3 (NP_002569, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5063
Clone Number 1H7
Iso type IgG2a Kappa

Enviar un mensaje


PAK3 monoclonal antibody (M07), clone 1H7

PAK3 monoclonal antibody (M07), clone 1H7