Ver mas grande
PAK2 monoclonal antibody (M01), clone 1E1
AB-H00005062-M01
Producto nuevo
PAK2 monoclonal antibody (M01), clone 1E1
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | PAK2 |
| Gene Alias | PAK65|PAKgamma |
| Gene Description | p21 protein (Cdc42/Rac)-activated kinase 2 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Ti,WB-Re,S-ELISA,ELISA,PLA-Ce |
| Immunogen Prot. Seq | DSNTVKQKYLSFTPPEKDGFPSGTPALNAKGTEAPAVVTEEEDDDEETAPPVIAPRPDHTKSIYTRSVIDPVPAPVGDSHVDGAAKSLDKQKKKTKMTDE |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | PAK2 (NP_002568, 131 a.a. ~ 230 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 5062 |
| Clone Number | 1E1 |
| Iso type | IgG1 Kappa |
Más información
Mouse monoclonal antibody raised against a partial recombinant PAK2.