PAK2 monoclonal antibody (M01), clone 1E1
  • PAK2 monoclonal antibody (M01), clone 1E1

PAK2 monoclonal antibody (M01), clone 1E1

Ref: AB-H00005062-M01
PAK2 monoclonal antibody (M01), clone 1E1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PAK2.
Información adicional
Size 100 ug
Gene Name PAK2
Gene Alias PAK65|PAKgamma
Gene Description p21 protein (Cdc42/Rac)-activated kinase 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Re,S-ELISA,ELISA,PLA-Ce
Immunogen Prot. Seq DSNTVKQKYLSFTPPEKDGFPSGTPALNAKGTEAPAVVTEEEDDDEETAPPVIAPRPDHTKSIYTRSVIDPVPAPVGDSHVDGAAKSLDKQKKKTKMTDE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PAK2 (NP_002568, 131 a.a. ~ 230 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5062
Clone Number 1E1
Iso type IgG1 Kappa

Enviar un mensaje


PAK2 monoclonal antibody (M01), clone 1E1

PAK2 monoclonal antibody (M01), clone 1E1