PAK2 purified MaxPab rabbit polyclonal antibody (D01P)
  • PAK2 purified MaxPab rabbit polyclonal antibody (D01P)

PAK2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00005062-D01P
PAK2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human PAK2 protein.
Información adicional
Size 100 ug
Gene Name PAK2
Gene Alias PAK65|PAKgamma
Gene Description p21 protein (Cdc42/Rac)-activated kinase 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MSDNGELEDKPPAPPVRMSSTIFSTGGKDPLSANHSLKPLPSVPEEKKPRHKIISIFSGTEKGSKKKEKERPEISPPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKLEQKKNPQAVLDVLKFYDSNTVKQKYLSFTPPEKDGFPSGTPALNAKGTEAPAVVTEEEDDDEETAPPVIAPRPDHTKSIYTRSVIDPVPAPVGDSHVDGAAKSLDKQKKKTKMTDEEIMEKLRTIVSIGDPKKKYTRYEKI
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PAK2 (NP_002568.2, 1 a.a. ~ 524 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5062

Enviar un mensaje


PAK2 purified MaxPab rabbit polyclonal antibody (D01P)

PAK2 purified MaxPab rabbit polyclonal antibody (D01P)