PAK1 polyclonal antibody (A01)
  • PAK1 polyclonal antibody (A01)

PAK1 polyclonal antibody (A01)

Ref: AB-H00005058-A01
PAK1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PAK1.
Información adicional
Size 50 uL
Gene Name PAK1
Gene Alias MGC130000|MGC130001|PAKalpha
Gene Description p21 protein (Cdc42/Rac)-activated kinase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq APRPEHTKSVYTRSVIEPLPVTPTRDVATSPISPTENNTTPPDALTRNTEKQKKKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PAK1 (NP_002567, 191 a.a. ~ 280 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5058

Enviar un mensaje


PAK1 polyclonal antibody (A01)

PAK1 polyclonal antibody (A01)