SERPINB2 monoclonal antibody (M08), clone 3A9
  • SERPINB2 monoclonal antibody (M08), clone 3A9

SERPINB2 monoclonal antibody (M08), clone 3A9

Ref: AB-H00005055-M08
SERPINB2 monoclonal antibody (M08), clone 3A9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SERPINB2.
Información adicional
Size 100 ug
Gene Name SERPINB2
Gene Alias HsT1201|PAI|PAI-2|PAI2|PLANH2
Gene Description serpin peptidase inhibitor, clade B (ovalbumin), member 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,IP,S-ELISA,ELISA
Immunogen Prot. Seq MEDLCVANTLFALNLFKHLAKASPTQNLFLSPWSISSTMAMVYMGSRGSTEDQMAKVLQFNEVGANAVTPMTPENFTSCGFMQQIQKGSYPDAILQAQAA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SERPINB2 (AAH12609, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5055
Clone Number 3A9
Iso type IgG2b Kappa

Enviar un mensaje


SERPINB2 monoclonal antibody (M08), clone 3A9

SERPINB2 monoclonal antibody (M08), clone 3A9