PAFAH2 purified MaxPab rabbit polyclonal antibody (D01P)
  • PAFAH2 purified MaxPab rabbit polyclonal antibody (D01P)

PAFAH2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00005051-D01P
PAFAH2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human PAFAH2 protein.
Información adicional
Size 100 ug
Gene Name PAFAH2
Gene Alias FLJ26025|HSD-PLA2
Gene Description platelet-activating factor acetylhydrolase 2, 40kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MGVNQSVGFPPVTGPHLVGCGDVMEGQNLQGSFFRLFYPCQKAEETMEQPLWIPRYEYCTGLAEYLQFNKRCGGLLFNLAVGSCRLPVSWNGPFKTKDSGYPLIIFSHGLGAFRTLYSAFCMELASRGFVVAVPEHRDRSAATTYFCKQAPEENQPTNESLQEEWIPFRRVEEGEKEFHVRNPQVHQRVSECLRVLKILQEVTAGQTVFNILPGGLDLMTLKGNIDMSRVAVMGHSFGGATAILALAKETQFRCA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PAFAH2 (NP_000428.2, 1 a.a. ~ 392 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5051

Enviar un mensaje


PAFAH2 purified MaxPab rabbit polyclonal antibody (D01P)

PAFAH2 purified MaxPab rabbit polyclonal antibody (D01P)