PAFAH2 polyclonal antibody (A01)
  • PAFAH2 polyclonal antibody (A01)

PAFAH2 polyclonal antibody (A01)

Ref: AB-H00005051-A01
PAFAH2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PAFAH2.
Información adicional
Size 50 uL
Gene Name PAFAH2
Gene Alias FLJ26025|HSD-PLA2
Gene Description platelet-activating factor acetylhydrolase 2, 40kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq LMKKICAQHEQSRIITVLGSVHRSQTDFAFVTGNLIGKFFSTETRGSLDPYEGQEVMVRAMLAFLQKHLDLKEDYNQWNNLIEGIGPSLTPGAPHHLSSL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PAFAH2 (NP_000428, 293 a.a. ~ 392 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5051

Enviar un mensaje


PAFAH2 polyclonal antibody (A01)

PAFAH2 polyclonal antibody (A01)