PAEP purified MaxPab rabbit polyclonal antibody (D01P)
  • PAEP purified MaxPab rabbit polyclonal antibody (D01P)

PAEP purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00005047-D01P
PAEP purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human PAEP protein.
Información adicional
Size 100 ug
Gene Name PAEP
Gene Alias GD|GdA|GdF|GdS|MGC138509|MGC142288|PAEG|PEP|PP14
Gene Description progestagen-associated endometrial protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MLCLLLTLGVALVCGVPAMDIPQTKQDLELPKLAGTWHSMAMATNNISLMATLKAPLRVHITSLLPTPEDNLEIVLHRWENNSCVEKKVLGEKTENPKKFKINYTVANEATLLDTDYDNFLFLCLQDTTTPIQSMMCQYLARVLVEDDEIMQGFIRAFRPLPRHLWYLLDLKQMEEPCRF
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PAEP (NP_002562.2, 1 a.a. ~ 180 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5047

Enviar un mensaje


PAEP purified MaxPab rabbit polyclonal antibody (D01P)

PAEP purified MaxPab rabbit polyclonal antibody (D01P)