PA2G4 polyclonal antibody (A01)
  • PA2G4 polyclonal antibody (A01)

PA2G4 polyclonal antibody (A01)

Ref: AB-H00005036-A01
PA2G4 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PA2G4.
Información adicional
Size 50 uL
Gene Name PA2G4
Gene Alias EBP1|HG4-1|p38-2G4
Gene Description proliferation-associated 2G4, 38kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq MSGEDEQQEQTIAEDLVVTKYKMGGDIANRVLRSLVEASSSGVSVLSLCEKGDAMIMEETGKIFKKEKEMKKGIAFPTSISVNNCVCHFSPLKSDQDYILKEGDLVKIDL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PA2G4 (AAH01951, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5036

Enviar un mensaje


PA2G4 polyclonal antibody (A01)

PA2G4 polyclonal antibody (A01)