P2RY1 polyclonal antibody (A01)
  • P2RY1 polyclonal antibody (A01)

P2RY1 polyclonal antibody (A01)

Ref: AB-H00005028-A01
P2RY1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant P2RY1.
Información adicional
Size 50 uL
Gene Name P2RY1
Gene Alias P2Y1
Gene Description purinergic receptor P2Y, G-protein coupled, 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MTEVLWPAVPNGTDAAFLAGPGSSWGNSTVASTAAVSSSFKCALTKTGFQFY
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen P2RY1 (NP_002554, 1 a.a. ~ 52 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5028

Enviar un mensaje


P2RY1 polyclonal antibody (A01)

P2RY1 polyclonal antibody (A01)