P2RX5 purified MaxPab rabbit polyclonal antibody (D01P)
  • P2RX5 purified MaxPab rabbit polyclonal antibody (D01P)

P2RX5 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00005026-D01P
P2RX5 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human P2RX5 protein.
Información adicional
Size 100 ug
Gene Name P2RX5
Gene Alias MGC47755|P2X5|P2X5R
Gene Description purinergic receptor P2X, ligand-gated ion channel, 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MGQAGCKGLCLSLFDYKTEKYVIAKNKKVGLLYRLLQASILAYLVVWVFLIKKGYQDVDTSLQSAVITKVKGVAFTNTSDLGQRIWDVADYVIPAQGENVFFVVTNLIVTPNQRQNVCAENEGIPDGACSKDSDCHAGEAVTAGNGVKTGRCLRRENLARGTCEIFAWCPLETSSRPEEPFLKEAEDFTIFIKNHIRFPKFNFSKSNVMDVKDRSFLKSCHFGPKNHYCPIFRLGSVIRWAGSDFQDIALEGGVI
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen P2RX5 (NP_002552.2, 1 a.a. ~ 422 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5026

Enviar un mensaje


P2RX5 purified MaxPab rabbit polyclonal antibody (D01P)

P2RX5 purified MaxPab rabbit polyclonal antibody (D01P)