P2RX5 polyclonal antibody (A01)
  • P2RX5 polyclonal antibody (A01)

P2RX5 polyclonal antibody (A01)

Ref: AB-H00005026-A01
P2RX5 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant P2RX5.
Información adicional
Size 50 uL
Gene Name P2RX5
Gene Alias MGC47755|P2X5|P2X5R
Gene Description purinergic receptor P2X, ligand-gated ion channel, 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq DGACSKDSDCHAGEAVTAGNGVKTGRCLRRENLARGTCEIFAWCPLETSSRPEEPFLKEAEDFTIFIKNHIRFPKFNFSKSNVMDVKDRSFLKSCHFGP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen P2RX5 (NP_002552, 126 a.a. ~ 224 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5026

Enviar un mensaje


P2RX5 polyclonal antibody (A01)

P2RX5 polyclonal antibody (A01)