OXCT1 polyclonal antibody (A01)
  • OXCT1 polyclonal antibody (A01)

OXCT1 polyclonal antibody (A01)

Ref: AB-H00005019-A01
OXCT1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant OXCT1.
Información adicional
Size 50 uL
Gene Name OXCT1
Gene Alias OXCT|SCOT
Gene Description 3-oxoacid CoA transferase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq DALLKTGVKGLTAVSNNAGVDNFGLGLLLRSKQIKRMVSSYVGENAEFERQYLS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen OXCT1 (NP_000427, 75 a.a. ~ 128 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5019

Enviar un mensaje


OXCT1 polyclonal antibody (A01)

OXCT1 polyclonal antibody (A01)