OXA1L MaxPab rabbit polyclonal antibody (D01)
  • OXA1L MaxPab rabbit polyclonal antibody (D01)

OXA1L MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00005018-D01
OXA1L MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human OXA1L protein.
Información adicional
Size 100 uL
Gene Name OXA1L
Gene Alias MGC133129
Gene Description oxidase (cytochrome c) assembly 1-like
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr,IP,IF
Immunogen Prot. Seq MAMGLMCGRRELLRLLQSGRRVHSVAGPSQWLGKPLTTRLLFPVAPCCCRPHYLFLAASGPRSLSTSAISFAEVQVQAPPVVAATPSPTAVPEVASGETADVVQTAAEQSFAELGLGSYTPVGLIQNLLEFMHVDLGLPWWGAIAACTVFARCLIFPLIVTGQREAARIHNHLPEIQKFSSRIREAKLAGDHIEYYKASSEMALYQKKHGIKLYKPLILPVTQAPIFISFFIALREMANLPVPSLQTGGLWWFQD
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen OXA1L (Q15070, 1 a.a. ~ 435 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 5018

Enviar un mensaje


OXA1L MaxPab rabbit polyclonal antibody (D01)

OXA1L MaxPab rabbit polyclonal antibody (D01)