OTX1 monoclonal antibody (M01), clone 1F2
  • OTX1 monoclonal antibody (M01), clone 1F2

OTX1 monoclonal antibody (M01), clone 1F2

Ref: AB-H00005013-M01
OTX1 monoclonal antibody (M01), clone 1F2

Información del producto

Mouse monoclonal antibody raised against a partial recombinant OTX1.
Información adicional
Size 100 ug
Gene Name OTX1
Gene Alias FLJ38361|MGC15736
Gene Description orthodenticle homeobox 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA,RNAi-Ab,IF
Immunogen Prot. Seq YGMNGLGLAGPAMDLLHPSVGYPATPRKQRRERTTFTRSQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQSGSGTKSRPAKKKSSPVR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen OTX1 (NP_055377, 10 a.a. ~ 116 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5013
Clone Number 1F2
Iso type IgG2a Kappa

Enviar un mensaje


OTX1 monoclonal antibody (M01), clone 1F2

OTX1 monoclonal antibody (M01), clone 1F2