OTX1 MaxPab rabbit polyclonal antibody (D01)
  • OTX1 MaxPab rabbit polyclonal antibody (D01)

OTX1 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00005013-D01
OTX1 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human OTX1 protein.
Información adicional
Size 100 uL
Gene Name OTX1
Gene Alias FLJ38361|MGC15736
Gene Description orthodenticle homeobox 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key IP
Immunogen Prot. Seq MMSYLKQPPYGMNGLGLAGPAMDLLHPSVGYPATPRKQRRERTTFTRSQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQSGSGTKSRPAKKKSSPVRESSGSESSGQFTPPAVSSSASSSSSASSSSANPAAAAAAGLGGNPVAAASSLSTPAASSIWSPASISPGSAPASVSVPEPLAAPSNTSCMQRSVAAGAATAAASYPMSYGQGGSYGQGYPTPSSSYFGGVDCSSYLAPM
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen OTX1 (NP_055377.1, 1 a.a. ~ 354 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 5013

Enviar un mensaje


OTX1 MaxPab rabbit polyclonal antibody (D01)

OTX1 MaxPab rabbit polyclonal antibody (D01)