OTX1 polyclonal antibody (A01)
  • OTX1 polyclonal antibody (A01)

OTX1 polyclonal antibody (A01)

Ref: AB-H00005013-A01
OTX1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant OTX1.
Información adicional
Size 50 uL
Gene Name OTX1
Gene Alias FLJ38361|MGC15736
Gene Description orthodenticle homeobox 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq YGMNGLGLAGPAMDLLHPSVGYPATPRKQRRERTTFTRSQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQSGSGTKSRPAKKKSSPVR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen OTX1 (NP_055377, 10 a.a. ~ 116 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5013

Enviar un mensaje


OTX1 polyclonal antibody (A01)

OTX1 polyclonal antibody (A01)