OSM MaxPab rabbit polyclonal antibody (D01)
  • OSM MaxPab rabbit polyclonal antibody (D01)

OSM MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00005008-D01
OSM MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human OSM protein.
Información adicional
Size 100 uL
Gene Name OSM
Gene Alias MGC20461
Gene Description oncostatin M
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MGVLLTQRTLLSLVLALLFPSMASMAAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRRHSPHQALRKGVRRTRPSRKGKRLMTRGQLPR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen OSM (NP_065391.1, 1 a.a. ~ 252 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 5008

Enviar un mensaje


OSM MaxPab rabbit polyclonal antibody (D01)

OSM MaxPab rabbit polyclonal antibody (D01)