OSBP monoclonal antibody (M01), clone 5A3
  • OSBP monoclonal antibody (M01), clone 5A3

OSBP monoclonal antibody (M01), clone 5A3

Ref: AB-H00005007-M01
OSBP monoclonal antibody (M01), clone 5A3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant OSBP.
Información adicional
Size 100 ug
Gene Name OSBP
Gene Alias OSBP1
Gene Description oxysterol binding protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq GATVLPANTPGNVGSGKDQCCSGKGDMSDEDDENEFFDAPEIITMPENLGHKRTGSNISGASSDISLDEQYKHQLEETKKEKRT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen OSBP (NP_002547.1, 324 a.a. ~ 407 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5007
Clone Number 5A3
Iso type IgG2a Kappa

Enviar un mensaje


OSBP monoclonal antibody (M01), clone 5A3

OSBP monoclonal antibody (M01), clone 5A3