ORC5L polyclonal antibody (A01)
  • ORC5L polyclonal antibody (A01)

ORC5L polyclonal antibody (A01)

Ref: AB-H00005001-A01
ORC5L polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant ORC5L.
Información adicional
Size 50 uL
Gene Name ORC5L
Gene Alias ORC5|ORC5P|ORC5T
Gene Description origin recognition complex, subunit 5-like (yeast)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq SSSQWEKLQKDDTDPGQLKGLSAHTHVELPYYSKFILIAAYLASYNPARTDKRFFLKHHGKIKKTNFLKKHEKTSNHLLGPKPFPLDRLLAILYSIVDSR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ORC5L (NP_002544, 274 a.a. ~ 373 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5001

Enviar un mensaje


ORC5L polyclonal antibody (A01)

ORC5L polyclonal antibody (A01)