ORC1L monoclonal antibody (M01), clone 3H1
  • ORC1L monoclonal antibody (M01), clone 3H1

ORC1L monoclonal antibody (M01), clone 3H1

Ref: AB-H00004998-M01
ORC1L monoclonal antibody (M01), clone 3H1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ORC1L.
Información adicional
Size 100 ug
Gene Name ORC1L
Gene Alias HSORC1|ORC1|PARC1
Gene Description origin recognition complex, subunit 1-like (yeast)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq MAHYPTRLKTRKTYSWVGRPLLDRKLHYQTYREMCVKTEGCSTEIHIQIGQFVLIEGDDDENPYVAKLLELFEDDSDPPPKKRARVQWFVRFCEVPACKRHLLGRKPGAQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ORC1L (AAH11539, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4998
Clone Number 3H1
Iso type IgG2b Kappa

Enviar un mensaje


ORC1L monoclonal antibody (M01), clone 3H1

ORC1L monoclonal antibody (M01), clone 3H1