OPRM1 polyclonal antibody (A01)
  • OPRM1 polyclonal antibody (A01)

OPRM1 polyclonal antibody (A01)

Ref: AB-H00004988-A01
OPRM1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant OPRM1.
Información adicional
Size 50 uL
Gene Name OPRM1
Gene Alias KIAA0403|MOR|MOR1|OPRM
Gene Description opioid receptor, mu 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Re,ELISA
Immunogen Prot. Seq MSDAQLGPLRLTLLSVSARTGFCKKQQELWQRRKEAAEALGTRKVSVLLATSHSGARPAVSTMDSSAAPTNASNCTDALAYSSCSPAPSPGSWVNLSHLDGNLSDPCGPN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen OPRM1 (NP_000905, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 4988

Enviar un mensaje


OPRM1 polyclonal antibody (A01)

OPRM1 polyclonal antibody (A01)