OPRL1 polyclonal antibody (A01)
  • OPRL1 polyclonal antibody (A01)

OPRL1 polyclonal antibody (A01)

Ref: AB-H00004987-A01
OPRL1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant OPRL1.
Información adicional
Size 50 uL
Gene Name OPRL1
Gene Alias KOR-3|MGC34578|NOCIR|OOR|ORL1
Gene Description opiate receptor-like 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq DILLGFWPFGNALCKTVIAIDYYNMFTSTFTLTAMSVDRYVAICHPIRALDVRTSSKAQAVNVAIWALASVVGVPVAIMGSAQVEDEEIECLVEIPTPQDYWG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen OPRL1 (AAH38433, 110 a.a. ~ 212 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 4987

Enviar un mensaje


OPRL1 polyclonal antibody (A01)

OPRL1 polyclonal antibody (A01)